I apologize in advance for the bad English.
First of all I invite you to information
http://www.cnio.es/es/index.asp and especially the work of Maria Blasco and if they could contact her if they wanted to help could be relevant because is an eminence in relation to telomeres, telomerase and its relationship to cancer. It handles very substantial information regarding what is discussed on this blog.
http://www.tascience...2008Article.pdfhttp://www.cnio.es/e...-18feb08-es.pdfhttp://www.cnio.es/e...b-nota-0705.pdfThe astragalus Zahlbruckneri-Hand-Mazz of Turkish origin (Turkey) Astragaliside IV contains in its root (of a specimen of this variety and provenance astragaliside IV was obtained in an investigation of gastric protection capacity of that molecule-inter-) The The research did Jesus Arrieta Valencia for his doctorate in "doctor in medicine research" presented at the national polytechnic institute in research and graduate secretary in Mexico City
In the database: Comparative Toxicogenomics Database, for cycloastragenol is the following entry:
http://ctd.mdibl.org...hem&acc=C061014The image is of saponin known in this group but provides information that I find interesting:
Name: cycloastragenol
CAS Type 1 Name: 9.19-Cyclolanostane-3 ,6,16,25-tetrol, 20.24-epoxy-, (3beta, 6alpha, 16beta, 24R) --
CAS Registry Number: 84605-18-5
And
Equivalent Terms: astramembrangenin; cyclogalegigenin
The term cyclogalegigenin:
http://direct.bl.uk/...om=searchenginehttp://www.springerl...5862tm87240k6l/Astragalus is very interesting caucasicus of Georgia and therefore contact with the people who wrote the article.
Other stuff:
In another entry in this blog has appointed these articles interesting:
Khavinson VKH, Bondarev IE, Butyugov AA. Khavinson VKH, Bondarev IE, Butyugov AA.
Epithalon peptide induces telomerase activity and telomere elongation in human somatic cells. E
Bull Exp Biol Med Bull Exp Biol Med 2003 Jun; 135 (6) :590-2.
Khavinson VKH, Bondarev IE, Butyugov AA, Smirnova TD. Khavinson VKH, Bondarev IE, Butyugov AA, Smirnova TD.
Peptide promotes overcoming of the division limit in human somatic cell.
Bull Exp Biol Med Bull Exp Biol Med 2004 May; 137 (5) :503-6.
Anisimov VN, Popovich IG, Zabezhinski? MA, Rozenfel'd SV, Khavinson VKH, Semenchenko AV Iashin AI. Anisimov VN, Popovich IG, Zabezhinski? MA, Rozenfel'd SV, Khavinson VKH, Semenchenko AV Iashin IA.
[Effect of epitalon and melatonin on life span and spontaneous carcinogenesis in senescence accelerated mice (SAM)]
Vopr Onkol. Vopr Onkol. 2005, 51 (1) :93-8
Melatonin is secreted in many areas of the body outside the pineal gland (trant gastrointestinal immune system, cutaneous, harderiana gland, retina, cerebero, epithelium, respiratory system, liver, kidney, adrenal gland, thyroid, pancreas, ovary, placenta , endometrium, carotid body, mast cells, NK cells, eosinophils, leukocytes, platelets, endothelial cells, Purkinje cells, hypothalamus and cell lines: Jurkat, U937, 3T3, BCG1, NB41A3, F9, MDCK)
In the pineal gland tryptophan hydroxylase with troptofano give 5-Hydroxytryptophan Decarboxylase copn of anina that would aromatic serotonin (a neutrotrasmisor of many hallucinogens like structure but not the same and would be responsible for improving the input to the brain and mental activity in full physical conscious) Arilalquilanina ester with N-N-acetilransferasa would acetilserotonina and with this e Hydroxyindole-O-methyltransferase melatonin would occur epithelial epitelion related.
Melatonin seems to be oncostátic, cronobiotic, inmunoregulator, antioxidant regulaciora of sexual maturation and anti-aging: It has been supplied in adult rodent melatonin and its life is prolonged by 10% to 15% more (eliminating the shortening in pineal gland a similar proportion of half life) thus pineal melatonin, as suggested by these articles could be behind the formation of epitelion (Ala-Glu-Asp-Gly) and the oligopeptide (first synthesized in the St. Petersburg Institute of bioregulation and Gerontology.) would be the natural activator of telomerase (but only extends the life a small percentage with natural processes)
The root of Rhodiola Rosea plant (or Russian Rhodiola) located in areas far north in Europe and Asia includes among its Componenet one called rosavin
http://www.anti-agin...diolaRosea.htmlRosavin molecule is a precursor of serotonin, without being an introduction or a hallucinogen serotonin in the body allows for greater availability of serotonin and thus improve mental activity, attention, and stimulates the activity and allow other in theory that the pineal gland synthesize more melatonin during sleep (hours sleep every night would be appropriate, therefore, extremely important)
Could it be that yes or no. But a test with flies that were fed the roots of Rhodiola rosea living a meda showed a 10% increase. Which tallies with the supply of melatonin and its relationship to epitelion
So it seems more than likely making rosavin or infusions of Rhodiola rosea along with a calendar of adequate sleep (at night-epithelial gland is photosensitive and responds to stimuli of light or darkness to ue serotonin or melatonin occurs days or night target species as an owl light produces melatonin unlike humans, for example-and at least 8 hours every day) would make any more epitelion available in the body.
The rosavin increases blood pressure (unlike the lower astragalisodos) therefore could be combined properly to avoid causing undesirable changes in blood or adjust to each person as if you have hypertension or hypotension (intend to calculate the appropriate amount that to counteract to that effect).
Explain because I rolled in this point as though nothing else release him before
Telomerase contains the length you should have no telomere shortening when activated but only got a bit longer than the total amount
Which is very convenient in case of suicide replicative cells with apoptosis, by stopping the activation of telomerase to continue copying again shortened telomeres and killing the harmful cells without ever becoming cancer and when not in restoring and activating telomere telomerase regularly before harmful cells die from lack of telomere-so it is very necessary to calculate the dose of activator and the time between shots as you take the dose as an inhibitor or reverastrol epigallocatechin-3-gallate from tea avoiding the coupling of telomerase and be more like Controlled Substances, or if you can have problems, but not as a rule, as its regular intake after taking telomerase activators, simply would drastically reduce the doses of these activators (no point increasing the dosage of chitosan add astragaloside IV or if after a short time he takes an inhibitor of telomerase action unless the dose is too high or become too straight shots. Another thing is the day to shoot these inhibitors after a activators making correct doses and times to let it end up killing themselves have entered the cells into apoptosis replicative harmlessly)
What are a little longer and not the total amount is very interesting. When the gene is activated telomerase tert forms a protein called T1 and you do not know too well how it works
Based on the current telomeres form a microRNA called something like tel-RNA that mark precisely the length and create a limit of what can be repaired (by ensuring cellular aging long-term yet temporary current lengthening securely against the possibility of a cancer)
The action of telomerase and how to repair as the tel-arn and other species is controlled by a small routine set in a micro RNA: the "miR-290" only present in placental mammals. The destruction of this microRNA causes an excessive production of telomerase bringing it directly to a cancerous tumor. This makes controls microRNAs as Rbl2 silence the gene family of retinoblastoma. The Rbl2 is a gene that repeated activation is responsible for excessive lengthening of telomeres and telomerase act without control. Rbl2 gene inhibits the enzymes Dnmt1, Dnmt3a and DNMT3B.
This seems important because in the miR-290 would be to control the process does not leave the safety limits
The oligopeptide epitelion (naturally present) would give the order to activate telomerase and miR-290 would control that became more or less attention to that more or less active order. In turn, the tel-RNA with these controls allow only one unit longer shop at the time of activation and not reinstate the full length.
I personally think that would make that request cycloastagenol activation was most consistently attended allowing lengthening over time rather than making his regular shortening and that would explain that with the TA-64 and just as regularly making some people are elongate six months in both the telomeres and others so little.
So I propose to combine well cycloastragenol or its derivatives hydrolyzable this (as astragaloside IV and others) and chitosan with rosavin or extract or infusion or whatever the root of Rhodiola rosea.
I still have more.
Tea has many antioxidants but contains an inhibitor of telomerase activity (making it more anti-cancer but their abuse could be counterproductive, however contains teine or caffeine - the same molecule is that of coffee) In contrast Rooibos does not contain this molecule in addition to a variety of antioxidants including Rooibos contains Super Oxide Dismutase, this molecule destroys the reactive forms of oxygen called superoxide also sometimes issued in the mitochondria for energy and activity that cause nuclear DNA damage causes entheogens rather than exogenous. The activity of mitochondria is to get energy and if abused the food is causing more of the superoxides but also to consume with exercise although it is very healthy and lower the total proportion of antioxidants. It would therefore be desirable to attach this form of "tea" but not "tea" per se as an infusion fluid in taking telomerase activators. It also has anticancer properties as the contribution of antioxidants and could be quite adequate.
And I think it would be appropriate because precisely suggest the root extract of Rhodiola rosea or supplement rosavin directly instead of melatonin (which can be invoked as a separate food supplement) to have more serotonin available and help increase the physical and mental activity .
So far the substances comment one is Asian or European origin, one from northern Russia, other African and other marine ...
The production of telomerase is not the only form of immortalization of cancers, another is the removal of undesirable elements called autophagy that keep the cell in good condition and would be undesirable forms in addition to the cause of some cancers also of the endometriosis (a disease of the female endometrium). And, as this would be the basis of maintaining nerve cells in good condition, avoiding diseases such as Alzheimer's (where wastes accumulate to disable neurons). It was recently announced in Nature that a molecule associated with maturation, reproductive cycles and the immune system known as spermidine cells would eliminate their waste and remain healthy long (something like instead of using antioxidants to protect nuclear DNA make them clean the cell to avoid that sort of damage that could force the deleting) but as in the activation of telomerase using spermidine appears that could cause damage and other types of cancer are not based on maintenance of telomere length. Therefore it takes much to be usable, I think.
It seems that a compound used as fabric dye for observation and as a tracer in an operation (which is poisonous in high doses) at doses of 60mg slows the accumulation and damage to the neurons in the case of Alzheimer's, destroying the links tau proteins garbage ...
I refer to
Metiltioninio or Cloruro of Phenothiazine-5-ium, 3,7-bis (dimethylamino) -, chloride, commonly known as methylene blue C16H18ClN3S.xH2O M. = 319.85 + H2O CAS: 61-73-4 EC: 200 -- 515-2
That if you take a little blue urine ... (has been used for jokes)
Anyway, it seems to originate new neurons in the brain in the cerebral cortex and encouraged its production with exercise with antidepressants and with the consumption of "blueberries" or at least this has happened in mice. But these new neurons are automatically destroyed after two weeks of training needed to maintain intellectual activity than usual or very high during most of the time.
So that part could be your solution
And then there's another cause of tissue damage over time yet.
A damaged tissue in mammals is populated not lack the same tissue but from a poorly differentiated called scar tissue. Words that makes you see a scar where the damage is external but also internal causes this tissue to repair both physical damage as bruises and other damage caused by various diseases. This fabric is of poor quality, like when telomeres are shortened there are fewer cells available to form the tissue in the other case is filled with pieces of fabric wrong and when large enough quantity also cause the same problems as the tissue aged.
Not all living things make up this tissue and everywhere. And it seems to have a relationship with telomere and telomerase curious.
A whale has generated less telomerase and telomeres shorter than a salamander instead live much longer. That seems a contradiction that is being discussed.
If a salamander was axelote or make a cut heal like us but, if a limb is regenerated back to mammals which we passed. Except in the liver.
According to Ken Muneoka, Majong Han and David M. Garnier seems that both we and the wound healed but oxelote in oxelote if the nerve regenerates through amputee member (with an injury and managed to move a nerve that would grow an extra leg to one and salamanders)
Human epidermis in adipose tissue, muscle, bone, nerve and vascular tissue regenerate after a minor injury but does not have that capacity to regenerate the dermis (and when there is a deep cut is damaged) the dermis has many types of cells and some of them are fibroblasts, these are primarily active in the regeneación members of a salamander, however, in humans (in mammals but it) does not do that but are scars, scar tissue, poor tissue regeneration ending with him and any is how and where damaged organs causing problems in the long run when more there.
When there is damage to the immune cells come to the place they turn emit signals that dermal fibroblasts surrounding tissue fibroblasts. Fibroblasts are an "extracellular matrix" is growing and hybridizing aberrant scar tissue forming and a salamander fibroblasts stop producing matrix when they occupy an area to move to a next phase. However, in the epithelium of a mammalian fetal wounds heal without scarring. So whatever they seem to be genes that are turned off after or changing in any way but we can share at least in part because it does not regenerate in the entire limb maimed and several genes that appear to regenerate limbs are activated in the embryo as Fgf8 and Wnt7a but in the differentiation of the ectoderm are disabled and curiously in salamanders epidermmicas cells produce wound that Fgf8 and Wnt7a are genes that perform functions in embryonic development as a temporary dedifferentiation. In the salamander the next stage is the formation of what she called a blastema in these genes are activated Fgf8 and Wnt7a and enters a state similar to embryonic development but as an adult member and regenerating the fibroblasts seem to have a kind of salamander of memory space coordinate system of the embryonic stage to regenerate the member correctly, but it turns out that according to Howard Y. Chang and John L. Stanford Rinn adult human fibroblasts also have that memory instead of simply passing the phase of blastema and continue and continue as in the salamander the process stops without the activation of these genes. Ken Muneoka, Majong Han and David M. Garnier have found a natural blastema in amputated wound and create a mouse but still no experimental confirmation that when it comes to the stage of blastema blastema provides the same signals that inhibit fibrosis in the wound. They feel safe to think that they can regenerate a limb or an organ, and believe that maybe in ten years can be.
It has had the idea that if certain parts of the adult body, the process works and the liver or elsewhere may occur around the chemical signals, proteins that inhibit fibrosis and permit the continuation of regeneration. There was a story in the media that I could not confirm its veracity in this Lee Mr Spievak an amputee had more than an inch of finger and would have such powders for four weeks delivered by his brother who work in this area and was supposedly regenerated piece of finger amputee: nail, bones, muscles, everything and only correct that the notary as calloused skin and the nail grow faster
Here is the list of substances in extracellular matrix obtained for this purpose:
http://www.mirm.pitt...ojects.Host.aspObviously not the same one centimeter scar tissue in a whale than a centimeter on a stove (or a small animal). A small animal has to repair the wounds more effectively and that means many new copies of cells must therefore have much longer telomeres and / or generate more telomerase to avoid aging faster and even more if it is to regenerate the whole tissue to replace an entire limb.
In addition to live shorter half it is less relevant than the process eventually cause cancer and more likely than before to have problems with this will have died of old
The activation of genes in humans Member rebuild or use of substances containing the signals for further differentiation is needed that would activate telomerase in a more abundant and controlled so that the tissue formed in addition to not scar is not old. And if you are a member, part of an organ piece, equal etc.. Lee said Mr Spievak seems that the piece of finger she grew up is different about consistency and so on.
More
Years ago I saw that he proposed a telomerase activator of several patents that were requested (actually a transactivator, which was found by searching for the cause of diseases in which telomerase is not activated ")
I refer to the nucleotide sequence of Sequence or associated peptides: dyskerin 24.2 of the GSE.
The total sequence dyskerin has 514 amino acids, but the GSE 24.2 is 55
Adding this by virus vectors, liposomes or other mechanisms (hydrolysis in the stomach destroys a very long sequence of ammonia and it is difficult to penetrate the cell membrane) appear to be active telomerase production about 140 days in a row
The total sequence is dyskerin
MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIK PESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNP LKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEK TGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGI VRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLR VRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLG LLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLY DNHKDESYLRR --- V --- VYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAK
IKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAK
RKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE
The amino acid that have separated - V - on purpose is that in its mutated form causes dyskeratosis congenita and telomerase is not active in the person suffering is crucial for both the GSE 24.2 sequence
The mutant is the dyskerin:
MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIK PESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNP LKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEK TGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGI VRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLR VRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLG LLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLY DNHKDESYLRR --- F --- VYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDH
Database seems to have found loose in the cells containing that amino acid fragment:
RVVYPLEK identified as Pap00425566
Arginine / Valine / Valine / tyrosine / Proline / Leucine / glutamic acid / lysine
After looking at items that make cancers grow capillaries of different size and quimitoterapia that works well on cancer cells in vitro does not work equally well in vivo because they simply do not get to have more narrow capillaries and the lack of oxygen were still favors these cancers (by having better autophagy can make better use of own resources and not require much input supply and also have to supply their products to the agency to serve) I thought a potent activator of telomerase (as derived from the dyskerin) could be safe if used a powerful anticancer but were both molecules within a liposome so that the cell to reach him telomerase activator sure that you come to the cancer.
Of anticancer seems that capsaicin, the molecule that makes spicy food spicy-activator is damage control by the micondrías but cause digestive problems and nerves are sensitive to it (there is a similarly named but is synthetic civamina )
Roche Laboratories have created an activator of the p53 gene (control by nuclear DNA) called nutlin. The best version is the molecule nutlin-3a, is a synthetic molecules and drugs called smart because it only works when certain elements are present in proteins that have not been damaged, which may cause malfunction P53 (nutlin-3: CAS 548,472 -- 68-0). Evidenemte is synthesis. That there is a molecule similar in nature or obtainable with changes ...
And another molecule (also synthetic) which orders cancer cell apoptosis (and little or not healthy) AZD-2281 is also called Olaparib
http://en.wikipedia.org/wiki/OlaparibI have more information about this and hung on
http://www.ecreencia...index.php/topic speculation, 403.0.html
Although in Castilian (ie in Spanish from Spain, I'm sorry, but if someone dominates, or use a good translator ...)
I hope you understand something and serve as useful.
Shilima khemen
This topic is locked
